This is a working overview of prothymosin alpha, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-05-29. Anything still debated is marked as such rather than presented as settled.
Biologically, the peptide is studied mainly in the context of immune cell development and regulation. It is produced in the thymus and in several other tissues, and it appears to influence the maturation and activity of T cells and other immune populations. Laboratory work describes effects on cytokine production, on the balance between T cell subsets, and on the function of dendritic cells. Much of this evidence comes from cell culture and animal models, so the extent to which the same pathways operate in humans remains an open question.
Clinical interest has centered on chronic viral hepatitis, on immune restoration in various conditions, and on use as an adjuvant intended to improve responses to vaccines. Trials have reported mixed results, and regulatory status differs sharply between countries; in some places it is a prescription product, while elsewhere it is sold without an approved therapeutic indication. Because published studies vary widely in design, population, and endpoints, comparisons across them are difficult and no single conclusion covers the whole literature.
Identity and purity are assessed with a small set of standard peptide methods. Reversed-phase high-performance liquid chromatography separates the main peak from truncated or oxidized species, and its area percentage is the usual purity measure. Mass spectrometry confirms the observed molecular mass against the expected value, while amino acid analysis or peptide mapping checks composition and sequence. Specifications for research-grade material are often stated as 95 percent or higher, though the exact limit depends on the supplier and the intended use.
Laboratory supplies of the peptide usually arrive as a lyophilized powder in sealed vials. The powder is hygroscopic, so a vial should be allowed to reach room temperature before it is opened to prevent condensation on the contents. Weighing and transfer are best performed in a low-humidity environment with clean tools. Once dissolved, the solution should be mixed gently rather than vortexed, because foaming and shear can reduce recovery of the peptide.
Storage recommendations center on low temperature, dryness, and protection from repeated freezing and thawing. The intact powder is commonly held at 20 degrees below zero Celsius or colder, while a working solution is divided into single-use aliquots to limit freeze-thaw cycles. Buffered saline or phosphate-buffered saline at neutral pH is frequently used as a diluent. Light sensitivity is not well documented, yet amber vials or foil wrapping are common practice for long-term storage of peptide stocks.
| Property | Value | Notes |
|---|---|---|
| Molecular mass | Approximately 3,108 Da | Consistent with a 28-residue acetylated peptide |
| Residue count | 28 | Corresponds to the amino terminal region of prothymosin alpha |
| Appearance of dry powder | White to off-white solid | Slight variation between lots is normal |
| Solubility class | Freely soluble in water | Low solubility in most organic solvents |
| Common synonyms | Thymosin alpha 1, T alpha 1 | The numeral reflects an early fraction numbering scheme |
Within the immune system, the peptide acts on several cell types rather than a single target. Reported activities include promotion of T-cell maturation, enhancement of natural killer cell activity, and modulation of cytokine production by dendritic cells and macrophages. Some of these effects appear to operate through toll-like receptor signaling, though the precise receptor-level mechanism remains debated. Whether the observed immune changes translate into clinical benefit is a separate question and depends on the indication studied.
The peptide was described in the 1970s as a component of thymic extracts, and early research focused on restoring immune function in immunodeficiency states. A synthetic version entered clinical development in the 1980s and is approved as a drug in several countries for conditions such as chronic hepatitis B and certain immunodeficiencies. Approval status varies widely by jurisdiction, and in the United States it is not an approved therapeutic. Regulatory and clinical positions differ, so statements about efficacy should be tied to specific indications and studies.
Identity and purity are usually checked by reverse-phase high-performance liquid chromatography, which separates the intact chain from truncated products, together with mass spectrometry for confirmation of the expected mass. Peptide mapping after enzymatic digestion and amino acid analysis add sequence-level evidence. Release testing also covers water content, residual solvents, and counter-ions, all of which influence measured mass and stability. Related-peptide limits are commonly expressed as a percentage of total peak area, with individual unspecified impurities held below a lower threshold.
The lyophilized peptide is a white to off-white powder that dissolves freely in water and in aqueous buffers near neutral pH. Because the molecule carries a net negative charge under physiological conditions, saline and phosphate solutions are the usual vehicles, while strongly acidic media are avoided. Stock solutions are commonly divided into small aliquots so that repeated freezing and thawing can be limited, since cycling may encourage aggregation. Solubility in organic solvents is poor and those solvents are seldom used as primary diluents.
For some wine styles, such as light, fruity wines or for low-acid wines from warm climates, malolactic fermentation is not desired. Winemakers can take several steps to prevent MLF from taking place, including:
== See also == List of major Lucha Libre AAA Worldwide events List of AEW PPV events List of ECW supercards and PPV events List of FMW supercards and PPV events List of GFW specials and PPV events List of MLW specials and PPV events List of NWA PPV events List of major NJPW events List of ROH PPV events List of TNA / Impact Wrestling PPV events List of TNA+ Specials List of WCCW supercard events List of WCW closed-circuit events and PPV events List of WCW Clash of the Champions shows List of WWE Saturday Night's Main Event shows List of WWE Tribute to the Troops shows
=== Soviet use of RTGs === Many Beta-M RTGs produced by the Soviet Union to power lighthouses and beacons have become orphaned sources of radiation. Its design allowed for the use of normal industrial bolts instead of intrinsically safe or safety interlocked bolts (most likely to reduce cost), and did not require the use of intrinsically safe opening mechanisms or made any use of tamper resistant shielding systems. Several of these units have also been illegally dismantled for scrap metal, or been exposed to storm conditions, freezing and water penetration, common issues in those abandoned in the harsh Russian arctic. Some have even fallen into the ocean, or have defective shielding due to poor design or physical damage. The US Department of Defense cooperative threat reduction program has expressed concern that material from the Beta-M RTGs can be used by terrorists to construct a dirty bomb. However, the strontium titanate perovskite used is resistant to all likely forms of environmental degradation and cannot melt or dissolve in water. Bioaccumulation is unlikely as SrTiO3 passes through the digestive tract of humans or other animals unchanged, but the animal or human who ingested it would still receive a significant radiation dose to the sensitive intestinal lining during passage. Mechanical degradation of "pebbles" or larger objects into fine dust is more likely and could disperse the material over a wider area, however this would also reduce the risk of any single exposure event resulting in a high dose.
Corticotropin-releasing hormone receptor 1 (CRHR1) is a protein, also known as CRF1, with the latter (CRF1) now being the IUPHAR-recommended name. In humans, CRF1 is encoded by the CRHR1 gene at region 17q21.31, beside micrototubule-associated protein tau MAPT.
== List of hosts == Amur Cossack Host (1860–1918) Astrakhan Cossack Host (1737–1920) Azov Cossack Host (1832–1862) Baikal Cossack Host (1851-1920) Bashkir Host (1798-1865) Black Sea Cossack Host (1787–1864) Buh Cossack Host (1769–1817) Caucasus Line Cossack Host (1832–1860) Danube Cossack Host (1828–1868), an Imperial Russian Cossack Host formed from descendants of the Zaporozhian Cossacks Don Cossack Host (1570-1918, reconstituted in 1992) Greben Cossacks Host (1711–1745–1845-60–1920, reconstituted in 1992) Kuban Cossack Host (1860–1920, reconstituted in 1992) Orenburg Cossack Host (1755–1920) Semiryechye Cossack Host (1867–1920) Siberian Cossack Host (1582-1918) Terek Cossack Host (1577–1792–1860–1920, reconstituted in 1992) Transbaikal Cossack Host (1851–1920) Ural Cossack Host (c. 14th century-end–1920) Ussuri Cossack Host (1889–1922, re-established in 1990) Volga Cossack Host (1734–1777) Zaporozhian Host (1572/1649–1775), of the Zaporozhian Cossacks who lived in Zaporizhia, Dnieper Ukraine, during the 16th — 18th centuries.
Sources: en.wikipedia.org
== Further reading == Goldsmith, WM (1945). "Trepanation and the 'CatlinMark'". American Antiquity. 10 (4): 348–52. doi:10.2307/275576. JSTOR 275576. S2CID 163518652. Guerra Doce, E (2006). "Evidencias del consumo de drogas en Europa durante la Prehistoria". Trastornos Adictivos (in Spanish). 8 (1): 53–61. doi:10.1016/S1575-0973(06)75106-6. Archived from the original on 15 May 2008. Retrieved 14 November 2010. Gurlt, EJ (1898). "VI: Volkschirurgie in Japan in alter und neuerer". Geschichte der Chirurgie und ihrer Ausübung (in German). Vol. 1. Berlin: Verlag von August Hirschwald. p. 83. Retrieved 14 November 2010. Hrdlicka, A (1939). "Trepanation among prehistoric people, especially in America". Ciba Foundation Symposium. 1 (6): 170–7. Matsuki, A (2005). "A brief history of the biographical study of Seishu Hanaoka". Nihon Ishigaku Zasshi (in Japanese). 51 (3): 355–84. ISSN 0549-3323. PMID 16450478. Retrieved 14 November 2010. Matsuki, A (2006). "Why did Hanaoka's Method of Anesthesia Decay Rapidly at the End of the Edo Period?". Nihon Ishigaku Zasshi (in Japanese). 52 (1): 40–1. ISSN 0549-3323. Ruffer, MA (1918). "Studies in paleopathology. Some recent researches on prehistoric trephining". Journal of Pathology and Bacteriology. 22: 90–104. doi:10.1002/path.1700220109. Stewart, TD (1958). "Stone Age skull surgery. A general review with emphasis on the New World". Smithsonian Annual Report of the Board of Regents, 1957. pp. 469–91.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
== Epigenetics == The MTHFR aberrant promoter hypermethylation is associated with male infertility. Furthermore, this improper epigenetic phenomenon was observed in semen samples of infertile males belonging to couples with a history of recurrent spontaneous abortion. The MTHFR improper promoter hypermethylation may affect the two essential roles of DNA methylation in spermatogenetic cells, the global genome methylation process and the genomic imprinting of paternal genes. In addition, MTHFR gene promoter hypermethylation has also been associated with methylation loss at H19 imprinted gene in semen samples from infertile males.
== Refusal == In the United States federal criminal system, refusing to take a drug test triggers an automatic revocation of probation or supervised release. In Victoria, Australia the driver of the car has the option to refuse the drug test. Refusing to undergo a drug test or refusing to undergo a secondary drug test after the first one, triggers an automatic suspension and disqualification for a period of two years and a fine of AUD$1000. The second refusal triggers an automatic suspension and disqualification for a period of four years and an even larger fine.
Sources: en.wikipedia.org
The name reflects an early convention for naming thymus-derived fractions. The peptide is characterized and measured as a defined molecule, and it does not operate through a single classical endocrine axis.
Aliquots are typically frozen well below zero Celsius and thawed only once, since repeated cycles promote aggregation and loss. Dilution into a neutral buffer limits degradation during short working periods, and prolonged storage at room temperature is avoided.
Research material is commonly offered at 95 percent purity or above by chromatographic area, with some suppliers listing 98 percent. Higher grades usually carry a higher price and are chosen when the assay is sensitive to trace impurities.
Mass spectrometry is the standard check, often paired with amino acid analysis or peptide mapping. A chromatographic retention time alone is generally considered insufficient for structural confirmation.